COPB2,beta'-COP
  • COPB2,beta'-COP

Anti-COPB2 Antibody 100ul

Ref: AN-HPA058180-100ul
Anti-COPB2

Información del producto

Polyclonal Antibody against Human COPB2, Gene description: coatomer protein complex, subunit beta 2 (beta prime), Alternative Gene Names: beta'-COP, betaprime-COP, Validated applications: ICC, Uniprot ID: P35606, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name COPB2
Gene Description coatomer protein complex, subunit beta 2 (beta prime)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence GNANMVNKLAEGAERDGKNNVAFMSYFLQGKVDACLELLIRTGRLPEAAFLARTYLPSQVSRVVKLWRENLSKVNQKAAE
Immunogen GNANMVNKLAEGAERDGKNNVAFMSYFLQGKVDACLELLIRTGRLPEAAFLARTYLPSQVSRVVKLWRENLSKVNQKAAE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names beta'-COP, betaprime-COP
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P35606
HTS Code 3002150000
Gene ID 9276
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-COPB2 Antibody 100ul

Anti-COPB2 Antibody 100ul