SKP1,EMC19,MGC34403
  • SKP1,EMC19,MGC34403

Anti-SKP1 Antibody 100ul

Ref: AN-HPA058134-100ul
Anti-SKP1

Información del producto

Polyclonal Antibody against Human SKP1, Gene description: S-phase kinase-associated protein 1, Alternative Gene Names: EMC19, MGC34403, OCP-II, OCP2, p19A, SKP1A, TCEB1L, Validated applications: ICC, Uniprot ID: P63208, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SKP1
Gene Description S-phase kinase-associated protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKE
Immunogen MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names EMC19, MGC34403, OCP-II, OCP2, p19A, SKP1A, TCEB1L
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P63208
HTS Code 3002150000
Gene ID 6500
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SKP1 Antibody 100ul

Anti-SKP1 Antibody 100ul