TMEM52B,C12orf59
  • TMEM52B,C12orf59

Anti-TMEM52B Antibody 25ul

Ref: AN-HPA058096-25ul
Anti-TMEM52B

Información del producto

Polyclonal Antibody against Human TMEM52B, Gene description: transmembrane protein 52B, Alternative Gene Names: C12orf59, FLJ31166, Validated applications: ICC, IHC, WB, Uniprot ID: Q4KMG9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TMEM52B
Gene Description transmembrane protein 52B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence QLPSSLDTLPGYEEALHMSRFTVAMCGQKAPDLPPVPEEKQLPPTEKESTRIVDSWN
Immunogen QLPSSLDTLPGYEEALHMSRFTVAMCGQKAPDLPPVPEEKQLPPTEKESTRIVDSWN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C12orf59, FLJ31166
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q4KMG9
HTS Code 3002150000
Gene ID 120939
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TMEM52B Antibody 25ul

Anti-TMEM52B Antibody 25ul