AGO2,EIF2C2,hAGO2
  • AGO2,EIF2C2,hAGO2

Anti-AGO2 Antibody 25ul

Ref: AN-HPA058075-25ul
Anti-AGO2

Información del producto

Polyclonal Antibody against Human AGO2, Gene description: argonaute RISC catalytic component 2, Alternative Gene Names: EIF2C2, hAGO2, Q10, Validated applications: ICC, Uniprot ID: Q9UKV8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name AGO2
Gene Description argonaute RISC catalytic component 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence IQGYAFKPPPRPDFGTSGRTIKLQANFFEMDI
Immunogen IQGYAFKPPPRPDFGTSGRTIKLQANFFEMDI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names EIF2C2, hAGO2, Q10
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UKV8
HTS Code 3002150000
Gene ID 27161
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-AGO2 Antibody 25ul

Anti-AGO2 Antibody 25ul