EXOSC7,EAP1,hRrp42p
  • EXOSC7,EAP1,hRrp42p

Anti-EXOSC7 Antibody 100ul

Ref: AN-HPA057980-100ul
Anti-EXOSC7

Información del producto

Polyclonal Antibody against Human EXOSC7, Gene description: exosome component 7, Alternative Gene Names: EAP1, hRrp42p, KIAA0116, p8, RRP42, Rrp42p, Validated applications: IHC, Uniprot ID: Q15024, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name EXOSC7
Gene Description exosome component 7
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence EDLRVDGRGCEDYRCVEVETDVVSNTSGSARVKLGHTDILVGVKAEMGTPKLEKPNEGYLEFFVDCSASATPEFEGRGGDDLGTEIANTLYRI
Immunogen EDLRVDGRGCEDYRCVEVETDVVSNTSGSARVKLGHTDILVGVKAEMGTPKLEKPNEGYLEFFVDCSASATPEFEGRGGDDLGTEIANTLYRI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names EAP1, hRrp42p, KIAA0116, p8, RRP42, Rrp42p
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15024
HTS Code 3002150000
Gene ID 23016
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-EXOSC7 Antibody 100ul

Anti-EXOSC7 Antibody 100ul