PKN2,Pak-2,PRK2
  • PKN2,Pak-2,PRK2

Anti-PKN2 Antibody 25ul

Ref: AN-HPA057913-25ul
Anti-PKN2

Información del producto

Polyclonal Antibody against Human PKN2, Gene description: protein kinase N2, Alternative Gene Names: Pak-2, PRK2, PRKCL2, STK7, Validated applications: ICC, IHC, WB, Uniprot ID: Q16513, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PKN2
Gene Description protein kinase N2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB, IHC
Sequence ASSLGEIDESSELRVLDIPGQDSETVFDIQNDRNSILPKSQSEYKPDTPQSGLEYSGIQELEDRRSQQRFQFNLQDFR
Immunogen ASSLGEIDESSELRVLDIPGQDSETVFDIQNDRNSILPKSQSEYKPDTPQSGLEYSGIQELEDRRSQQRFQFNLQDFR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Pak-2, PRK2, PRKCL2, STK7
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q16513
HTS Code 3002150000
Gene ID 5586
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PKN2 Antibody 25ul

Anti-PKN2 Antibody 25ul