XCL1,ATAC,LPTN,LTN
  • XCL1,ATAC,LPTN,LTN

Anti-XCL1 Antibody 25ul

Ref: AN-HPA057725-25ul
Anti-XCL1

Información del producto

Polyclonal Antibody against Human XCL1, Gene description: chemokine (C motif) ligand 1, Alternative Gene Names: ATAC, LPTN, LTN, lymphotactin, SCM-1, SCM-1a, SCYC1, Validated applications: IHC, Uniprot ID: P47992, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name XCL1
Gene Description chemokine (C motif) ligand 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence VCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
Immunogen VCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ATAC, LPTN, LTN, lymphotactin, SCM-1, SCM-1a, SCYC1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P47992
HTS Code 3002150000
Gene ID 6375
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-XCL1 Antibody 25ul

Anti-XCL1 Antibody 25ul