CLCNKA,hClC-Ka
  • CLCNKA,hClC-Ka

Anti-CLCNKA Antibody 100ul

Ref: AN-HPA057717-100ul
Anti-CLCNKA

Información del producto

Polyclonal Antibody against Human CLCNKA, Gene description: chloride channel, voltage-sensitive Ka, Alternative Gene Names: hClC-Ka, Validated applications: IHC, Uniprot ID: P51800, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CLCNKA
Gene Description chloride channel, voltage-sensitive Ka
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence IVKKLPYLPRILGRNIGSHHVRVEHFMNHSITTLA
Immunogen IVKKLPYLPRILGRNIGSHHVRVEHFMNHSITTLA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names hClC-Ka
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P51800
HTS Code 3002150000
Gene ID 1187
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CLCNKA Antibody 100ul

Anti-CLCNKA Antibody 100ul