ACSM2A,A-923A4.1
  • ACSM2A,A-923A4.1

Anti-ACSM2A Antibody 25ul

Ref: AN-HPA057699-25ul
Anti-ACSM2A

Información del producto

Polyclonal Antibody against Human ACSM2A, Gene description: acyl-CoA synthetase medium-chain family member 2A, Alternative Gene Names: A-923A4.1, ACSM2, MGC150530, Validated applications: IHC, WB, Uniprot ID: Q08AH3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ACSM2A
Gene Description acyl-CoA synthetase medium-chain family member 2A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence LRKVQGLCTLWGTQMSSRTLYINSRQLVSLQWGHQEVPAKFNFASDVLDHWAD
Immunogen LRKVQGLCTLWGTQMSSRTLYINSRQLVSLQWGHQEVPAKFNFASDVLDHWAD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names A-923A4.1, ACSM2, MGC150530
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q08AH3
HTS Code 3002150000
Gene ID 123876
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ACSM2A Antibody 25ul

Anti-ACSM2A Antibody 25ul