CHST14,D4ST-1,D4ST1
  • CHST14,D4ST-1,D4ST1

Anti-CHST14 Antibody 100ul

Ref: AN-HPA057697-100ul
Anti-CHST14

Información del producto

Polyclonal Antibody against Human CHST14, Gene description: carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14, Alternative Gene Names: D4ST-1, D4ST1, HD4ST, Validated applications: ICC, Uniprot ID: Q8NCH0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CHST14
Gene Description carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence AYRNKFGEIREYQQRYGAEIVRRYRAGAGPSPAGDDVTFPEFLRYLVDEDPERMNEHWMPVYHLCQPCAVHY
Immunogen AYRNKFGEIREYQQRYGAEIVRRYRAGAGPSPAGDDVTFPEFLRYLVDEDPERMNEHWMPVYHLCQPCAVHY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names D4ST-1, D4ST1, HD4ST
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8NCH0
HTS Code 3002150000
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CHST14 Antibody 100ul

Anti-CHST14 Antibody 100ul