PPIG,CARS-Cyp
  • PPIG,CARS-Cyp

Anti-PPIG Antibody 100ul

Ref: AN-HPA057469-100ul
Anti-PPIG

Información del producto

Polyclonal Antibody against Human PPIG, Gene description: peptidylprolyl isomerase G (cyclophilin G), Alternative Gene Names: CARS-Cyp, SCAF10, SRCyp, Validated applications: IHC, Uniprot ID: Q13427, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PPIG
Gene Description peptidylprolyl isomerase G (cyclophilin G)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence QRMRVSSGERWIKGDKSELNEIKENQRSPVRVKERKITDHRNVSESPNRKNEKEKKVKDHKSNSKERDIRRNSEKEDKYKNKVKKRAKSKS
Immunogen QRMRVSSGERWIKGDKSELNEIKENQRSPVRVKERKITDHRNVSESPNRKNEKEKKVKDHKSNSKERDIRRNSEKEDKYKNKVKKRAKSKS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CARS-Cyp, SCAF10, SRCyp
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q13427
HTS Code 3002150000
Gene ID 9360
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PPIG Antibody 100ul

Anti-PPIG Antibody 100ul