WDR72,FLJ38736
  • WDR72,FLJ38736

Anti-WDR72 Antibody 100ul

Ref: AN-HPA057410-100ul
Anti-WDR72

Información del producto

Polyclonal Antibody against Human WDR72, Gene description: WD repeat domain 72, Alternative Gene Names: FLJ38736, Validated applications: IHC, WB, Uniprot ID: Q3MJ13, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name WDR72
Gene Description WD repeat domain 72
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence GHSYIYQLLNSGLSKSIYPADGRVLKETIYPHLLCSTSVQENKEQSRPFVMGYMNERKEPFYKVLFSGEVSGRITLWHIPDVPVSKFDGSPREIPVTATWTLQDNFDKHDTMSQSIIDYF
Immunogen GHSYIYQLLNSGLSKSIYPADGRVLKETIYPHLLCSTSVQENKEQSRPFVMGYMNERKEPFYKVLFSGEVSGRITLWHIPDVPVSKFDGSPREIPVTATWTLQDNFDKHDTMSQSIIDYF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ38736
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q3MJ13
HTS Code 3002150000
Gene ID 256764
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-WDR72 Antibody 100ul

Anti-WDR72 Antibody 100ul