LONRF2,FLJ45273
  • LONRF2,FLJ45273

Anti-LONRF2 Antibody 25ul

Ref: AN-HPA057366-25ul
Anti-LONRF2

Información del producto

Polyclonal Antibody against Human LONRF2, Gene description: LON peptidase N-terminal domain and ring finger 2, Alternative Gene Names: FLJ45273, RNF192, Validated applications: ICC, IHC, Uniprot ID: Q1L5Z9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name LONRF2
Gene Description LON peptidase N-terminal domain and ring finger 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence LAPDDNSLLLLRAELYLTMKNYEQALQDASAACQNEPLLIKGHQVKAQALSGLGRSKEVLKEFLYC
Immunogen LAPDDNSLLLLRAELYLTMKNYEQALQDASAACQNEPLLIKGHQVKAQALSGLGRSKEVLKEFLYC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ45273, RNF192
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q1L5Z9
HTS Code 3002150000
Gene ID 164832
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-LONRF2 Antibody 25ul

Anti-LONRF2 Antibody 25ul