ATP5F1
  • ATP5F1

Anti-ATP5F1 Antibody 25ul

Ref: AN-HPA057347-25ul
Anti-ATP5F1

Información del producto

Polyclonal Antibody against Human ATP5F1, Gene description: ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1, Validated applications: ICC, IHC, WB, Uniprot ID: P24539, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ATP5F1
Gene Description ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence LDYHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIAKCIADLKLLAKKAQAQPVM
Immunogen LDYHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIAKCIADLKLLAKKAQAQPVM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P24539
HTS Code 3002150000
Gene ID 515
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ATP5F1 Antibody 25ul

Anti-ATP5F1 Antibody 25ul