TEAD1,AA,TCF13,TEF-1
  • TEAD1,AA,TCF13,TEF-1

Anti-TEAD1 Antibody 100ul

Ref: AN-HPA057339-100ul
Anti-TEAD1

Información del producto

Polyclonal Antibody against Human TEAD1, Gene description: TEA domain family member 1 (SV40 transcriptional enhancer factor), Alternative Gene Names: AA, TCF13, TEF-1, Validated applications: ICC, Uniprot ID: P28347, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TEAD1
Gene Description TEA domain family member 1 (SV40 transcriptional enhancer factor)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence VSATAIHNKLGLPGIPRPTFPGAPGFWPGMIQTGQPGSSQDVKPFVQQAYPIQPAVTAPIPGFEPASA
Immunogen VSATAIHNKLGLPGIPRPTFPGAPGFWPGMIQTGQPGSSQDVKPFVQQAYPIQPAVTAPIPGFEPASA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AA, TCF13, TEF-1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P28347
HTS Code 3002150000
Gene ID 7003
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TEAD1 Antibody 100ul

Anti-TEAD1 Antibody 100ul