GON4L,FLJ20203
  • GON4L,FLJ20203

Anti-GON4L Antibody 25ul

Ref: AN-HPA057305-25ul
Anti-GON4L

Información del producto

Polyclonal Antibody against Human GON4L, Gene description: gon-4-like (C. elegans), Alternative Gene Names: FLJ20203, GON-4, GON4, Validated applications: ICC, Uniprot ID: Q3T8J9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name GON4L
Gene Description gon-4-like (C. elegans)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence PMEEQDNEESEKRRKKKKGTKRKRDGRGQEGTLAYDLKLDDMLDRTLEDGAKQHNLTAVNVRNILHEVITNEHVVAMMKAAISETEDMPMFEPKMTRSKLKEVV
Immunogen PMEEQDNEESEKRRKKKKGTKRKRDGRGQEGTLAYDLKLDDMLDRTLEDGAKQHNLTAVNVRNILHEVITNEHVVAMMKAAISETEDMPMFEPKMTRSKLKEVV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ20203, GON-4, GON4
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q3T8J9
HTS Code 3002150000
Gene ID 54856
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-GON4L Antibody 25ul

Anti-GON4L Antibody 25ul