MRPS2,CGI-91
  • MRPS2,CGI-91

Anti-MRPS2 Antibody 100ul

Ref: AN-HPA057261-100ul
Anti-MRPS2

Información del producto

Polyclonal Antibody against Human MRPS2, Gene description: mitochondrial ribosomal protein S2, Alternative Gene Names: CGI-91, Validated applications: IHC, WB, Uniprot ID: Q9Y399, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MRPS2
Gene Description mitochondrial ribosomal protein S2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence IFEPHVAVRDAAKMNIPTVGIVDTNCNPCLITYPVPGNDDSPLAVHLYCRLFQTAITRAKEKRQQVEALYRLQGQKEPGDQGPAHPPGAD
Immunogen IFEPHVAVRDAAKMNIPTVGIVDTNCNPCLITYPVPGNDDSPLAVHLYCRLFQTAITRAKEKRQQVEALYRLQGQKEPGDQGPAHPPGAD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-91
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y399
HTS Code 3002150000
Gene ID 51116
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MRPS2 Antibody 100ul

Anti-MRPS2 Antibody 100ul