NABP2,hSSB1,MGC2731
  • NABP2,hSSB1,MGC2731

Anti-NABP2 Antibody 25ul

Ref: AN-HPA057213-25ul
Anti-NABP2

Información del producto

Polyclonal Antibody against Human NABP2, Gene description: nucleic acid binding protein 2, Alternative Gene Names: hSSB1, MGC2731, OBFC2B, SOSS-B1, SSB1, Validated applications: ICC, Uniprot ID: Q9BQ15, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NABP2
Gene Description nucleic acid binding protein 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence FSEPNPEYSTQQAPNKAVQNDSNPSASQPTTGPS
Immunogen FSEPNPEYSTQQAPNKAVQNDSNPSASQPTTGPS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names hSSB1, MGC2731, OBFC2B, SOSS-B1, SSB1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BQ15
HTS Code 3002150000
Gene ID 79035
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NABP2 Antibody 25ul

Anti-NABP2 Antibody 25ul