KDM3B,C5orf7,JMJD1B
  • KDM3B,C5orf7,JMJD1B

Anti-KDM3B Antibody 100ul

Ref: AN-HPA057202-100ul
Anti-KDM3B

Información del producto

Polyclonal Antibody against Human KDM3B, Gene description: lysine (K)-specific demethylase 3B, Alternative Gene Names: C5orf7, JMJD1B, KIAA1082, NET22, Validated applications: ICC, Uniprot ID: Q7LBC6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name KDM3B
Gene Description lysine (K)-specific demethylase 3B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence TLSSSPTEERPTVGPGQQDNPLLKTFSNVFGRHSGGFLSSPADFSQENKAPFEAVKRFSLDERSLACRQDSDSST
Immunogen TLSSSPTEERPTVGPGQQDNPLLKTFSNVFGRHSGGFLSSPADFSQENKAPFEAVKRFSLDERSLACRQDSDSST
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C5orf7, JMJD1B, KIAA1082, NET22
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7LBC6
HTS Code 3002150000
Gene ID 51780
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-KDM3B Antibody 100ul

Anti-KDM3B Antibody 100ul