FAM3A,2-19,DXS560S
  • FAM3A,2-19,DXS560S

Anti-FAM3A Antibody 100ul

Ref: AN-HPA056991-100ul
Anti-FAM3A

Información del producto

Polyclonal Antibody against Human FAM3A, Gene description: family with sequence similarity 3, member A, Alternative Gene Names: 2-19, DXS560S, XAP-7, Validated applications: ICC, Uniprot ID: P98173, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FAM3A
Gene Description family with sequence similarity 3, member A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence GFPRIQQLFTSPESSVTAAPRARKYKCGLPQPCPEEHLAFRVVSGAANVIG
Immunogen GFPRIQQLFTSPESSVTAAPRARKYKCGLPQPCPEEHLAFRVVSGAANVIG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 2-19, DXS560S, XAP-7
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P98173
HTS Code 3002150000
Gene ID 60343
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FAM3A Antibody 100ul

Anti-FAM3A Antibody 100ul