PPP5C,PP5,PPP5
  • PPP5C,PP5,PPP5

Anti-PPP5C Antibody 100ul

Ref: AN-HPA056933-100ul
Anti-PPP5C

Información del producto

Polyclonal Antibody against Human PPP5C, Gene description: protein phosphatase 5, catalytic subunit, Alternative Gene Names: PP5, PPP5, Validated applications: IHC, WB, Uniprot ID: P53041, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PPP5C
Gene Description protein phosphatase 5, catalytic subunit
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence PNYCDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNVKPMAYANTLLQLGMM
Immunogen PNYCDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNVKPMAYANTLLQLGMM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names PP5, PPP5
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P53041
HTS Code 3002150000
Gene ID 5536
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PPP5C Antibody 100ul

Anti-PPP5C Antibody 100ul