TEAD4,EFTR-2,RTEF-1
  • TEAD4,EFTR-2,RTEF-1

Anti-TEAD4 Antibody 100ul

Ref: AN-HPA056896-100ul
Anti-TEAD4

Información del producto

Polyclonal Antibody against Human TEAD4, Gene description: TEA domain family member 4, Alternative Gene Names: EFTR-2, RTEF-1, TCF13L1, TEF-3, TEFR-1, Validated applications: ICC, IHC, Uniprot ID: Q15561, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TEAD4
Gene Description TEA domain family member 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence ISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGP
Immunogen ISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names EFTR-2, RTEF-1, TCF13L1, TEF-3, TEFR-1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15561
HTS Code 3002150000
Gene ID 7004
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TEAD4 Antibody 100ul

Anti-TEAD4 Antibody 100ul