CCDC12,MGC23918
  • CCDC12,MGC23918

Anti-CCDC12 Antibody 100ul

Ref: AN-HPA056814-100ul
Anti-CCDC12

Información del producto

Polyclonal Antibody against Human CCDC12, Gene description: coiled-coil domain containing 12, Alternative Gene Names: MGC23918, Validated applications: ICC, IHC, WB, Uniprot ID: Q8WUD4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CCDC12
Gene Description coiled-coil domain containing 12
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence EALRRKERLKALREKTGRKDKEDGEPKTKHLREEEEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPVAVEEKVKEQLEAAK
Immunogen EALRRKERLKALREKTGRKDKEDGEPKTKHLREEEEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPVAVEEKVKEQLEAAK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC23918
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WUD4
HTS Code 3002150000
Gene ID 151903
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CCDC12 Antibody 100ul

Anti-CCDC12 Antibody 100ul