DPF2,BAF45d,REQ
  • DPF2,BAF45d,REQ

Anti-DPF2 Antibody 100ul

Ref: AN-HPA056786-100ul
Anti-DPF2

Información del producto

Polyclonal Antibody against Human DPF2, Gene description: D4, zinc and double PHD fingers family 2, Alternative Gene Names: BAF45d, REQ, ubi-d4, Validated applications: ICC, WB, Uniprot ID: Q92785, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DPF2
Gene Description D4, zinc and double PHD fingers family 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence AEEEGEDKEDSQPPTPVSQRSEEQKSKKGPDGLALPNNY
Immunogen AEEEGEDKEDSQPPTPVSQRSEEQKSKKGPDGLALPNNY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BAF45d, REQ, ubi-d4
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q92785
HTS Code 3002150000
Gene ID 5977
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DPF2 Antibody 100ul

Anti-DPF2 Antibody 100ul