FAM122A,C9orf42
  • FAM122A,C9orf42

Anti-FAM122A Antibody 25ul

Ref: AN-HPA056646-25ul
Anti-FAM122A

Información del producto

Polyclonal Antibody against Human FAM122A, Gene description: family with sequence similarity 122A, Alternative Gene Names: C9orf42, MGC17347, Validated applications: ICC, IHC, Uniprot ID: Q96E09, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name FAM122A
Gene Description family with sequence similarity 122A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence AQLSDPGVCVSSDTLDGNSSSAGSSCNSPAKVSTTTDSPVSPAQAASPFIPLDE
Immunogen AQLSDPGVCVSSDTLDGNSSSAGSSCNSPAKVSTTTDSPVSPAQAASPFIPLDE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C9orf42, MGC17347
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96E09
HTS Code 3002150000
Gene ID 116224
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FAM122A Antibody 25ul

Anti-FAM122A Antibody 25ul