ARHGAP5,GFI2,p190-B
  • ARHGAP5,GFI2,p190-B

Anti-ARHGAP5 Antibody 100ul

Ref: AN-HPA056507-100ul
Anti-ARHGAP5

Información del producto

Polyclonal Antibody against Human ARHGAP5, Gene description: Rho GTPase activating protein 5, Alternative Gene Names: GFI2, p190-B, p190BRhoGAP, RhoGAP5, Validated applications: ICC, Uniprot ID: Q13017, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ARHGAP5
Gene Description Rho GTPase activating protein 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence PLAHPEDMDPSDNYAEPIDTIFKQKGYSDEIYVVPDDSQNRIKIRNSFVNNTQGDEENGFSDRTSKSHGERRPSKYKYKSKTLFSKAKSYYRRTHSDASDDE
Immunogen PLAHPEDMDPSDNYAEPIDTIFKQKGYSDEIYVVPDDSQNRIKIRNSFVNNTQGDEENGFSDRTSKSHGERRPSKYKYKSKTLFSKAKSYYRRTHSDASDDE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GFI2, p190-B, p190BRhoGAP, RhoGAP5
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q13017
HTS Code 3002150000
Gene ID 394
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ARHGAP5 Antibody 100ul

Anti-ARHGAP5 Antibody 100ul