CENPM,C22orf18
  • CENPM,C22orf18

Anti-CENPM Antibody 100ul

Ref: AN-HPA056500-100ul
Anti-CENPM

Información del producto

Polyclonal Antibody against Human CENPM, Gene description: centromere protein M, Alternative Gene Names: C22orf18, CENP-M, MGC861, Pane1, Validated applications: ICC, Uniprot ID: Q9NSP4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CENPM
Gene Description centromere protein M
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence TEESLRHVDASFFLGKVCFLATGAGRESHCSIHRHTVVKLAHTYQSPLLYCDLEVEG
Immunogen TEESLRHVDASFFLGKVCFLATGAGRESHCSIHRHTVVKLAHTYQSPLLYCDLEVEG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C22orf18, CENP-M, MGC861, Pane1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NSP4
HTS Code 3002150000
Gene ID 79019
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CENPM Antibody 100ul

Anti-CENPM Antibody 100ul