CHMP5,C9orf83
  • CHMP5,C9orf83

Anti-CHMP5 Antibody 100ul

Ref: AN-HPA056437-100ul
Anti-CHMP5

Información del producto

Polyclonal Antibody against Human CHMP5, Gene description: charged multivesicular body protein 5, Alternative Gene Names: C9orf83, CGI-34, HSPC177, SNF7DC2, Vps60, Validated applications: IHC, WB, Uniprot ID: Q9NZZ3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CHMP5
Gene Description charged multivesicular body protein 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence KAYKQVKIDQIEDLQDQLEDMMEDANEIQEALSRSYGTPELDEDDLEAELD
Immunogen KAYKQVKIDQIEDLQDQLEDMMEDANEIQEALSRSYGTPELDEDDLEAELD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C9orf83, CGI-34, HSPC177, SNF7DC2, Vps60
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NZZ3
HTS Code 3002150000
Gene ID 51510
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CHMP5 Antibody 100ul

Anti-CHMP5 Antibody 100ul