ARC,Arg3.1,KIAA0278
  • ARC,Arg3.1,KIAA0278

Anti-ARC Antibody 100ul

Ref: AN-HPA056430-100ul
Anti-ARC

Información del producto

Polyclonal Antibody against Human ARC, Gene description: activity-regulated cytoskeleton-associated protein, Alternative Gene Names: Arg3.1, KIAA0278, Validated applications: ICC, Uniprot ID: Q7LC44, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ARC
Gene Description activity-regulated cytoskeleton-associated protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence ESTGGKYPVGSESARHTVSVGVGGPESYCHEADGYDYTVSPYAITPPPAAGELPGQEPAEAQQYQPWVPGEDGQPSPGVDTQIFEDPREFLS
Immunogen ESTGGKYPVGSESARHTVSVGVGGPESYCHEADGYDYTVSPYAITPPPAAGELPGQEPAEAQQYQPWVPGEDGQPSPGVDTQIFEDPREFLS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Arg3.1, KIAA0278
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7LC44
HTS Code 3002150000
Gene ID 23237
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ARC Antibody 100ul

Anti-ARC Antibody 100ul