FGFR1,BFGFR,CD331
  • FGFR1,BFGFR,CD331

Anti-FGFR1 Antibody 25ul

Ref: AN-HPA056402-25ul
Anti-FGFR1

Información del producto

Polyclonal Antibody against Human FGFR1, Gene description: fibroblast growth factor receptor 1, Alternative Gene Names: BFGFR, CD331, CEK, FLG, FLT2, H2, H3, H4, H5, KAL2, N-SAM, Validated applications: IHC, WB, Uniprot ID: P11362, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name FGFR1
Gene Description fibroblast growth factor receptor 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence LPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDDVQSINWLRDGVQLAESNRTR
Immunogen LPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDDVQSINWLRDGVQLAESNRTR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BFGFR, CD331, CEK, FLG, FLT2, H2, H3, H4, H5, KAL2, N-SAM
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P11362
HTS Code 3002150000
Gene ID 2260
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FGFR1 Antibody 25ul

Anti-FGFR1 Antibody 25ul