PPP1R3G
  • PPP1R3G

Anti-PPP1R3G Antibody 100ul

Ref: AN-HPA056393-100ul
Anti-PPP1R3G

Información del producto

Polyclonal Antibody against Human PPP1R3G, Gene description: protein phosphatase 1, regulatory subunit 3G, Validated applications: IHC, Uniprot ID: B7ZBB8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PPP1R3G
Gene Description protein phosphatase 1, regulatory subunit 3G
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence DAKKEPGAECFHFSLCLPPGLQPEDEEDADERGVAVHFAVCYRCAQGEYWDNNAGANYTLRY
Immunogen DAKKEPGAECFHFSLCLPPGLQPEDEEDADERGVAVHFAVCYRCAQGEYWDNNAGANYTLRY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID B7ZBB8
HTS Code 3002150000
Gene ID 648791
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PPP1R3G Antibody 100ul

Anti-PPP1R3G Antibody 100ul