CYP11B1,CPN1,CYP11B
  • CYP11B1,CPN1,CYP11B

Anti-CYP11B1 Antibody 25ul

Ref: AN-HPA056348-25ul
Anti-CYP11B1

Información del producto

Polyclonal Antibody against Human CYP11B1, Gene description: cytochrome P450, family 11, subfamily B, polypeptide 1, Alternative Gene Names: CPN1, CYP11B, FHI, P450C11, Validated applications: IHC, Uniprot ID: P15538, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CYP11B1
Gene Description cytochrome P450, family 11, subfamily B, polypeptide 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence RFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPR
Immunogen RFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CPN1, CYP11B, FHI, P450C11
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P15538
HTS Code 3002150000
Gene ID 1584
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CYP11B1 Antibody 25ul

Anti-CYP11B1 Antibody 25ul