MMS19,hMMS19,MET18
  • MMS19,hMMS19,MET18

Anti-MMS19 Antibody 25ul

Ref: AN-HPA056299-25ul
Anti-MMS19

Información del producto

Polyclonal Antibody against Human MMS19, Gene description: MMS19 nucleotide excision repair homolog (S. cerevisiae), Alternative Gene Names: hMMS19, MET18, MMS19L, Validated applications: ICC, IHC, WB, Uniprot ID: Q96T76, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MMS19
Gene Description MMS19 nucleotide excision repair homolog (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence IVPLFLDGNVSFLPENSFPSRFQPFQDGSSGQRRLIALLMAFVCSLPRNVEIPQLNQLMRELLELSCCHSCPFSSTAAAKCFAGLLNKHPA
Immunogen IVPLFLDGNVSFLPENSFPSRFQPFQDGSSGQRRLIALLMAFVCSLPRNVEIPQLNQLMRELLELSCCHSCPFSSTAAAKCFAGLLNKHPA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names hMMS19, MET18, MMS19L
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96T76
HTS Code 3002150000
Gene ID 64210
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MMS19 Antibody 25ul

Anti-MMS19 Antibody 25ul