KANK1,ANKRD15,KANK
  • KANK1,ANKRD15,KANK

Anti-KANK1 Antibody 25ul

Ref: AN-HPA056090-25ul
Anti-KANK1

Información del producto

Polyclonal Antibody against Human KANK1, Gene description: KN motif and ankyrin repeat domains 1, Alternative Gene Names: ANKRD15, KANK, KIAA0172, Validated applications: ICC, Uniprot ID: Q14678, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name KANK1
Gene Description KN motif and ankyrin repeat domains 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence APLGMMTGLDHYIERIQKLLAEQQTLLAENYSELAEAFGEPHSQMGSLNSQLISTLSSINSVMKSASTEELRNPDFQKTSLGKITGNYLGYTCKCGGLQSGSPLSSQTSQPEQEVGTSEGKPISSLDAFPTQEGTLSPVNLTDDQ
Immunogen APLGMMTGLDHYIERIQKLLAEQQTLLAENYSELAEAFGEPHSQMGSLNSQLISTLSSINSVMKSASTEELRNPDFQKTSLGKITGNYLGYTCKCGGLQSGSPLSSQTSQPEQEVGTSEGKPISSLDAFPTQEGTLSPVNLTDDQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ANKRD15, KANK, KIAA0172
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q14678
HTS Code 3002150000
Gene ID 23189
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-KANK1 Antibody 25ul

Anti-KANK1 Antibody 25ul