EEF2K,eEF-2K
  • EEF2K,eEF-2K

Anti-EEF2K Antibody 25ul

Ref: AN-HPA056061-25ul
Anti-EEF2K

Información del producto

Polyclonal Antibody against Human EEF2K, Gene description: eukaryotic elongation factor 2 kinase, Alternative Gene Names: eEF-2K, Validated applications: ICC, Uniprot ID: O00418, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name EEF2K
Gene Description eukaryotic elongation factor 2 kinase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence GFDYLLKAAEAGDRQSMILVARAFDSGQNLSPDRCQDWLEALHWYNTALEMTDCDEGGEYDGMQDEPRYMMLAREAEMLFTG
Immunogen GFDYLLKAAEAGDRQSMILVARAFDSGQNLSPDRCQDWLEALHWYNTALEMTDCDEGGEYDGMQDEPRYMMLAREAEMLFTG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names eEF-2K
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O00418
HTS Code 3002150000
Gene ID 29904
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-EEF2K Antibody 25ul

Anti-EEF2K Antibody 25ul