GFAP,FLJ45472
  • GFAP,FLJ45472

Anti-GFAP Antibody 100ul

Ref: AN-HPA056030-100ul
Anti-GFAP

Información del producto

Polyclonal Antibody against Human GFAP, Gene description: glial fibrillary acidic protein, Alternative Gene Names: FLJ45472, Validated applications: ICC, IHC, WB, Uniprot ID: , Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name GFAP
Gene Description glial fibrillary acidic protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse
Applications WB, IHC, ICC
Sequence LEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEVIKESKQEHKD
Immunogen LEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEVIKESKQEHKD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ45472
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
HTS Code 3002150000
Gene ID 2670
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-GFAP Antibody 100ul

Anti-GFAP Antibody 100ul