TNS3,FLJ13732
  • TNS3,FLJ13732

Anti-TNS3 Antibody 100ul

Ref: AN-HPA056015-100ul
Anti-TNS3

Información del producto

Polyclonal Antibody against Human TNS3, Gene description: tensin 3, Alternative Gene Names: FLJ13732, H_NH0549I23.2, TEM6, TENS1, Validated applications: ICC, IHC, Uniprot ID: Q68CZ2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TNS3
Gene Description tensin 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence VGSGPHPPDTQQPSPSKAFKPRFPGDQVVNGAGPELSTGPSPGSPTLDIDQSIEQLNRLILELDPTFEPIPTHMNALGSQANGSV
Immunogen VGSGPHPPDTQQPSPSKAFKPRFPGDQVVNGAGPELSTGPSPGSPTLDIDQSIEQLNRLILELDPTFEPIPTHMNALGSQANGSV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ13732, H_NH0549I23.2, TEM6, TENS1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q68CZ2
HTS Code 3002150000
Gene ID 64759
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TNS3 Antibody 100ul

Anti-TNS3 Antibody 100ul