OR13D1
  • OR13D1

Anti-OR13D1 Antibody 25ul

Ref: AN-HPA055921-25ul
Anti-OR13D1

Información del producto

Polyclonal Antibody against Human OR13D1, Gene description: olfactory receptor, family 13, subfamily D, member 1, Validated applications: IHC, Uniprot ID: Q8NGV5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name OR13D1
Gene Description olfactory receptor, family 13, subfamily D, member 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence ISIYLNHVLFYTTQQAGDLEHMETRNYSAMTEFFLV
Immunogen ISIYLNHVLFYTTQQAGDLEHMETRNYSAMTEFFLV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8NGV5
HTS Code 3002150000
Gene ID 286365
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-OR13D1 Antibody 25ul

Anti-OR13D1 Antibody 25ul