VPS54,HCC8,PPP1R164
  • VPS54,HCC8,PPP1R164

Anti-VPS54 Antibody 100ul

Ref: AN-HPA055894-100ul
Anti-VPS54

Información del producto

Polyclonal Antibody against Human VPS54, Gene description: vacuolar protein sorting 54 homolog (S. cerevisiae), Alternative Gene Names: HCC8, PPP1R164, Validated applications: ICC, Uniprot ID: Q9P1Q0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name VPS54
Gene Description vacuolar protein sorting 54 homolog (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence VDIMVSEDMKLTDSELGKLANNIQELLYSASDICHDRAVKFLMSRAKDGFLEKLNSMEFITLSRLMETFILDTEQICGRKSTSLLGAL
Immunogen VDIMVSEDMKLTDSELGKLANNIQELLYSASDICHDRAVKFLMSRAKDGFLEKLNSMEFITLSRLMETFILDTEQICGRKSTSLLGAL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HCC8, PPP1R164
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9P1Q0
HTS Code 3002150000
Gene ID 51542
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-VPS54 Antibody 100ul

Anti-VPS54 Antibody 100ul