JADE2,JADE-2
  • JADE2,JADE-2

Anti-JADE2 Antibody 100ul

Ref: AN-HPA055789-100ul
Anti-JADE2

Información del producto

Polyclonal Antibody against Human JADE2, Gene description: jade family PHD finger 2, Alternative Gene Names: JADE-2, KIAA0239, PHF15, Validated applications: ICC, Uniprot ID: Q9NQC1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name JADE2
Gene Description jade family PHD finger 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence IDGTFFNSWLAQSVQITAENMAMSEWPLNNGHREDPAPGLLSEELLQDEETLLSFMRDPSLRPGDPARKARG
Immunogen IDGTFFNSWLAQSVQITAENMAMSEWPLNNGHREDPAPGLLSEELLQDEETLLSFMRDPSLRPGDPARKARG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names JADE-2, KIAA0239, PHF15
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NQC1
HTS Code 3002150000
Gene ID 23338
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-JADE2 Antibody 100ul

Anti-JADE2 Antibody 100ul