FAM214B,bA182N22.6 Ver mas grande

Anti-FAM214B Antibody 100ul

AN-HPA055751-100ul

Producto nuevo

Anti-FAM214B

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 5 Biopuntos. Su cesta contiene un total 5 Biopuntos puede ser convertido en un Biobonos Descuento 20.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 100ul
Gene Name FAM214B
Gene Description family with sequence similarity 214, member B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence CPTKRRLLPAGEAPDVSSEEEGPAPRRRRGSLGHPTAANSSDAKATPFWSHLLPGPKEPVLDPTDCGPMGRRLKGARR
Immunogen CPTKRRLLPAGEAPDVSSEEEGPAPRRRRGSLGHPTAANSSDAKATPFWSHLLPGPKEPVLDPTDCGPMGRRLKGARR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bA182N22.6, FLJ11560, KIAA1539
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7L5A3
HTS Code 3002150000
Gene ID 80256
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicación IHC
Conjugation Unconjugated

Más información

Polyclonal Antibody against Human FAM214B, Gene description: family with sequence similarity 214, member B, Alternative Gene Names: bA182N22.6, FLJ11560, KIAA1539, Validated applications: IHC, Uniprot ID: Q7L5A3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image