NOXRED1,C14orf148
  • NOXRED1,C14orf148

Anti-NOXRED1 Antibody 25ul

Ref: AN-HPA055658-25ul
Anti-NOXRED1

Información del producto

Polyclonal Antibody against Human NOXRED1, Gene description: NADP-dependent oxidoreductase domain containing 1, Alternative Gene Names: C14orf148, FLJ32809, Validated applications: IHC, Uniprot ID: Q6NXP6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NOXRED1
Gene Description NADP-dependent oxidoreductase domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence ILNIKWLEGVFYAALNICTARNMAHSQVLQLLSELFLSVHFEDCGKDTASCPKLQLTDFVSKAYGKNLSQERPFPWFDLTAVQLKETPFSQHLSSSPVLQDHL
Immunogen ILNIKWLEGVFYAALNICTARNMAHSQVLQLLSELFLSVHFEDCGKDTASCPKLQLTDFVSKAYGKNLSQERPFPWFDLTAVQLKETPFSQHLSSSPVLQDHL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C14orf148, FLJ32809
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6NXP6
HTS Code 3002150000
Gene ID 122945
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NOXRED1 Antibody 25ul

Anti-NOXRED1 Antibody 25ul