NOP14,C4orf9,NOL14
  • NOP14,C4orf9,NOL14

Anti-NOP14 Antibody 100ul

Ref: AN-HPA055652-100ul
Anti-NOP14

Información del producto

Polyclonal Antibody against Human NOP14, Gene description: NOP14 nucleolar protein, Alternative Gene Names: C4orf9, NOL14, RES4-25, UTP2, Validated applications: ICC, Uniprot ID: P78316, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NOP14
Gene Description NOP14 nucleolar protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence LQELCQSTLTEMESQKQLCRPLTCEKSKPVPLKLFTPRLVKVLEFGRKQGSSKEEQERKRLIHKHKREFKGAVREIRKDNQFLARMQLSEIMER
Immunogen LQELCQSTLTEMESQKQLCRPLTCEKSKPVPLKLFTPRLVKVLEFGRKQGSSKEEQERKRLIHKHKREFKGAVREIRKDNQFLARMQLSEIMER
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C4orf9, NOL14, RES4-25, UTP2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P78316
HTS Code 3002150000
Gene ID 8602
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NOP14 Antibody 100ul

Anti-NOP14 Antibody 100ul