PPIL2,CYC4,Cyp-60
  • PPIL2,CYC4,Cyp-60

Anti-PPIL2 Antibody 100ul

Ref: AN-HPA055637-100ul
Anti-PPIL2

Información del producto

Polyclonal Antibody against Human PPIL2, Gene description: peptidylprolyl isomerase (cyclophilin)-like 2, Alternative Gene Names: CYC4, Cyp-60, UBOX7, Validated applications: ICC, Uniprot ID: Q13356, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PPIL2
Gene Description peptidylprolyl isomerase (cyclophilin)-like 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence QDPSYYLKNTNAETRETLQELYKEFKGDEILAATMKAPEKKKVDKLNAAHYSTGKVSASFTSTAMVPETTHEAAA
Immunogen QDPSYYLKNTNAETRETLQELYKEFKGDEILAATMKAPEKKKVDKLNAAHYSTGKVSASFTSTAMVPETTHEAAA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CYC4, Cyp-60, UBOX7
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q13356
HTS Code 3002150000
Gene ID 23759
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PPIL2 Antibody 100ul

Anti-PPIL2 Antibody 100ul