SEC22C,MGC13261
  • SEC22C,MGC13261

Anti-SEC22C Antibody 100ul

Ref: AN-HPA055594-100ul
Anti-SEC22C

Información del producto

Polyclonal Antibody against Human SEC22C, Gene description: SEC22 homolog C, vesicle trafficking protein, Alternative Gene Names: MGC13261, MGC5373, SEC22L3, Validated applications: ICC, Uniprot ID: Q9BRL7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SEC22C
Gene Description SEC22 homolog C, vesicle trafficking protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence TASYDTTCIGLASRPYAFLEFDSIIQKVKWHFNYVSSSQMECSLEKIQEELKLQPPAVLTLEDTDVANGVMNGHTPMHL
Immunogen TASYDTTCIGLASRPYAFLEFDSIIQKVKWHFNYVSSSQMECSLEKIQEELKLQPPAVLTLEDTDVANGVMNGHTPMHL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC13261, MGC5373, SEC22L3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BRL7
HTS Code 3002150000
Gene ID 9117
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SEC22C Antibody 100ul

Anti-SEC22C Antibody 100ul