FARP2,FIR,FRG
  • FARP2,FIR,FRG

Anti-FARP2 Antibody 25ul

Ref: AN-HPA055592-25ul
Anti-FARP2

Información del producto

Polyclonal Antibody against Human FARP2, Gene description: FERM, RhoGEF and pleckstrin domain protein 2, Alternative Gene Names: FIR, FRG, KIAA0793, PLEKHC3, Validated applications: ICC, Uniprot ID: O94887, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name FARP2
Gene Description FERM, RhoGEF and pleckstrin domain protein 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence VEESDNEWSVPHCFTIYAAQKTIVVAASTRLEKEKWMLDLNSAIQAAKSGGDTAPALPGRTVCTRPPRSPNEVSLEQESEDDARGVR
Immunogen VEESDNEWSVPHCFTIYAAQKTIVVAASTRLEKEKWMLDLNSAIQAAKSGGDTAPALPGRTVCTRPPRSPNEVSLEQESEDDARGVR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FIR, FRG, KIAA0793, PLEKHC3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O94887
HTS Code 3002150000
Gene ID 9855
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FARP2 Antibody 25ul

Anti-FARP2 Antibody 25ul