ZBTB8B,DKFZp547H154
  • ZBTB8B,DKFZp547H154

Anti-ZBTB8B Antibody 25ul

Ref: AN-HPA055553-25ul
Anti-ZBTB8B

Información del producto

Polyclonal Antibody against Human ZBTB8B, Gene description: zinc finger and BTB domain containing 8B, Alternative Gene Names: DKFZp547H154, RP1-27O5.1, ZNF916B, Validated applications: IHC, Uniprot ID: Q8NAP8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ZBTB8B
Gene Description zinc finger and BTB domain containing 8B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SNRPIICKGCRRTFTSHLSQGLRRFGLCDSCTCVTDTPDDDDDLMPINLSLVEASSESQEKSDTDNDWPIYVESEI
Immunogen SNRPIICKGCRRTFTSHLSQGLRRFGLCDSCTCVTDTPDDDDDLMPINLSLVEASSESQEKSDTDNDWPIYVESEI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZp547H154, RP1-27O5.1, ZNF916B
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8NAP8
HTS Code 3002150000
Gene ID 728116
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ZBTB8B Antibody 25ul

Anti-ZBTB8B Antibody 25ul