ZFYVE26,KIAA0321
  • ZFYVE26,KIAA0321

Anti-ZFYVE26 Antibody 25ul

Ref: AN-HPA055500-25ul
Anti-ZFYVE26

Información del producto

Polyclonal Antibody against Human ZFYVE26, Gene description: zinc finger, FYVE domain containing 26, Alternative Gene Names: KIAA0321, SPG15, Validated applications: IHC, Uniprot ID: Q68DK2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ZFYVE26
Gene Description zinc finger, FYVE domain containing 26
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence DSSKNESPPYSFVVRVPKADEVEWILDLKEEENELVRSEFYYEQAPSASLCIAILNLHRDSIACGHQLIEHCCRLSKGLTNPEVDAGLL
Immunogen DSSKNESPPYSFVVRVPKADEVEWILDLKEEENELVRSEFYYEQAPSASLCIAILNLHRDSIACGHQLIEHCCRLSKGLTNPEVDAGLL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0321, SPG15
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q68DK2
HTS Code 3002150000
Gene ID 23503
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ZFYVE26 Antibody 25ul

Anti-ZFYVE26 Antibody 25ul