ATP6V0D2,ATP6D2
  • ATP6V0D2,ATP6D2

Anti-ATP6V0D2 Antibody 100ul

Ref: AN-HPA055327-100ul
Anti-ATP6V0D2

Información del producto

Polyclonal Antibody against Human ATP6V0D2, Gene description: ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2, Alternative Gene Names: ATP6D2, FLJ38708, VMA6, Validated applications: IHC, WB, Uniprot ID: Q8N8Y2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ATP6V0D2
Gene Description ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence EDRETLYPTFGKLYPEGLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSG
Immunogen EDRETLYPTFGKLYPEGLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ATP6D2, FLJ38708, VMA6
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N8Y2
HTS Code 3002150000
Gene ID 245972
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ATP6V0D2 Antibody 100ul

Anti-ATP6V0D2 Antibody 100ul