DR1,NC2,NC2-BETA
  • DR1,NC2,NC2-BETA

Anti-DR1 Antibody 25ul

Ref: AN-HPA055308-25ul
Anti-DR1

Información del producto

Polyclonal Antibody against Human DR1, Gene description: down-regulator of transcription 1, TBP-binding (negative cofactor 2), Alternative Gene Names: NC2, NC2-BETA, Validated applications: ICC, IHC, WB, Uniprot ID: Q01658, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DR1
Gene Description down-regulator of transcription 1, TBP-binding (negative cofactor 2)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB, ICC
Sequence EVKEVLQECKTVALKRRKASSRLENLGIPEEELLRQQQELFAKARQQQAELAQQEWLQMQQ
Immunogen EVKEVLQECKTVALKRRKASSRLENLGIPEEELLRQQQELFAKARQQQAELAQQEWLQMQQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names NC2, NC2-BETA
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q01658
HTS Code 3002150000
Gene ID 1810
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DR1 Antibody 25ul

Anti-DR1 Antibody 25ul